PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00107074001
Common NameGSBRNA2T00107074001, LOC106446054, LOC106446055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 336aa    MW: 37665 Da    PI: 8.4585
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00107074001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.13e-31190244155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWt++LHe+Fv +v+ LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  GSBRNA2T00107074001 190 KTRIRWTQDLHEKFVACVNLLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRI 244
                          68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.81E-17188244IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22190244IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-27190244IPR009057Homeodomain-like
PfamPF002499.8E-8194243IPR001005SANT/Myb domain
PfamPF143794.9E-20257304IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MFLMQNWQSE ALMDNINFDS SNASQGSRLQ AQQPFHLQDV NMIHFNQSSP WTTETLSGFT  60
PYDCTVNQYF PVQCSSSKPY PPSFHQSSSL YQSQSMVPMQ PLQDQYQRSR ANDFAATKAS  120
SGSYTLSFEA SQDPQGLSRK TYSNSNVTPL NFSSSHHQPK QTHPRFSPPS SLSTHGGSVA  180
PNSGAVIGTK TRIRWTQDLH EKFVACVNLL GGADKATPKA ILKLMDSEGL TIFHVKSHLQ  240
KYRIVKYIPE SQEGSGVQIK EALQVQLDVQ RDLHEQLEIR RNLQLRIEEQ GKQLKRMIEQ  300
QQKTKESLLK TPNAETSSSL SDSDHSPRPF SVQDA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00107074001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013743176.10.0PREDICTED: uncharacterized protein LOC106446054 isoform X1
RefseqXP_013743179.10.0PREDICTED: uncharacterized protein LOC106446055 isoform X1
TrEMBLA0A078EDS50.0A0A078EDS5_BRANA; BnaC09g48760D protein
STRINGBra005912.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-158G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]